PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB07G27970.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HB-other
Protein Properties Length: 1195aa    MW: 135465 Da    PI: 7.281
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB07G27970.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox44.42.8e-1459111557
                   SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
      Homeobox   5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                   t+ ++ q++ Le+++ + +yp+ e ++e A+++gLt +qV++WF+ rR ke++
  OB07G27970.1  59 TKKSPLQIQMLERFYSEVQYPKSEYIAEYATSVGLTYSQVRIWFKERRRKERR 111
                   567899*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-1451112IPR009057Homeodomain-like
PROSITE profilePS5007114.62552112IPR001356Homeobox domain
SuperFamilySSF466891.75E-1253113IPR009057Homeodomain-like
SMARTSM003896.3E-1354116IPR001356Homeobox domain
PfamPF000461.2E-1159111IPR001356Homeobox domain
CDDcd000862.75E-759102No hitNo description
SMARTSM005710.0017418477IPR018501DDT domain
PROSITE profilePS5082710.183418477IPR018501DDT domain
PfamPF027916.2E-6420472IPR018501DDT domain
PfamPF156122.1E-5698729IPR028942WHIM1 domain
PfamPF156134.5E-10821892IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1195 aa     Download sequence    Send to blast
MGSVIGAAWV MGVGVGILWV VSFSVWLVEF EGQISIWLEL VWVVMVANSL EAKRENTGTK  60
KSPLQIQMLE RFYSEVQYPK SEYIAEYATS VGLTYSQVRI WFKERRRKER REMESLGAHM  120
EKQLNARSNG FRCNSSSSRF ASFSQSTIDH HVDNGMSFIG EKHALRPQVL FPKDYILRKV  180
FRKDGPPLGS EFDFLPQSAP RHLRDTTDYH FYQNRRVMKK RKIVELNTHR SSVPCEDSGR  240
VRKHGVGKGL MTVWQAMYSH SGKIQDGSNF IDETGCLRSL RPLDDYGRIE DCDDGKLIQK  300
KVLARKKVDK RSRPPSNRRK VQCSRVTAPK KHPPVECHLS VDESQSSELR TNQVTLVDDE  360
ELELSELQAG PNPLRCSVHR SSSGRHGCPL CKDLLARFPP PSVKMKQPFS TRPWESSPEM  420
VKKLFQVVRF IYNRFGYMDV HPFTFDELAQ AFHDKDSMLL GEVHVNLLKL LFVNTGRGSS  480
DVFVPRSSKD CRFLSFLNFV REQEFDLNFW IKSLNSLTWV EILRQVLVAS GFGSKHHMLN  540
RDFFNKVLEK NQMVKYGLRP RTLKGELFAL LSKKGSRGLK ISELAKSPEI VDLNIPSMEV  600
DQLIYSTLSS DITLFEKITP SAYRLRVDPR IKGKEDSGSD TEDSGSVDDD SDASSGADES  660
EGSHETSFSE HEHRITRRKR KNGHENVNRC SEIDESYSGE RWLLGLMEGE YSDLSIDEKL  720
DCLVALMDVV SGADTVPRLE EPPRVLPSIP RAQPHVSGGK IKKSTRNICQ SSDECFNTSG  780
SMHGLDSSMY QQSGSLRSHD YVAYSGRNDS STGVAHQPQV VLLGSDRRYN NYWLFLGPCS  840
ADDPGHHRVY FESSEDGHWE VIDSPQELLS LLASLDGRGI REAYLLASMK NRQTCLFEAM  900
KKHCEDRSVV GPEIPSETSH SETSSGDGAS PKLSSGDGAS PTSDIDYASV PTDLVDNIVN  960
PSSAISIEVG RRGDEKVLKW ERSQAFDKWI WTNFYSCLTA VKCGKKSFKE SLVRCESCHD  1020
LYWRDEKHCR ICHSTFEVSF DLEERYAIHV ATCRDPEDVY DVPNHKVLPS QLQALKAAIH  1080
AIEARMPEAA FAGLWMKSSH KLWIKRLRRT SSLAELLQVL VDFVGAMDED WLYKSSSSVS  1140
FSSYLDDITI YFQTMPQTTS AVALWVVKLD ALITPYLERA DSDRALSKDS LQTRT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1104111RRRKERRE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015695304.10.0PREDICTED: homeobox-DDT domain protein RLT3
RefseqXP_006657968.10.0PREDICTED: homeobox-DDT domain protein RLT3
TrEMBLJ3MN150.0J3MN15_ORYBR; Uncharacterized protein
STRINGOB07G27970.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45563350
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12750.10.0Homeodomain-like transcriptional regulator